PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy020193
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 287aa    MW: 31559.6 Da    PI: 6.1215
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58463913PU_refUnigeneView CDS
PUT-171a-Arachis_hypogaea-3766PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS384.71.1e-117227894374
       GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                +h+taNqaIlea++g++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p++++++ l+e+g++La++Ae+++v+fe++ +va++l+dl+ ++
  Ahy020193   2 AHFTANQAILEAFQGKNRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPAADNSDHLQEVGWKLAQLAETIHVEFEYRGFVANSLADLDASM 101
                7*************************************************************************************************** PP

       GRAS 194 Lrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                L+++p   Ea+aVn+v++lh+ll++++++e+    vL++v++++P++v+vveqea+hn++ Fl+rf+e+l+yys++fdsle ++   +++++++++++lg
  Ahy020193 102 LELRPseTEAVAVNSVFELHKLLARPGAVEK----VLSVVRQIRPEIVTVVEQEANHNGPGFLDRFTESLHYYSTMFDSLEGSV---NSQDKVMSEVYLG 194
                ****9999***********************....************************************************7...999999******* PP

       GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                ++i+nvvaceg +r+erhetl++Wr r+++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  Ahy020193 195 KQICNVVACEGVDRVERHETLGQWRTRFGSAGFAPVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLGWHTRPLIATSAWQ 278
                ***********************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.1581257IPR005202Transcription factor GRAS
PfamPF035143.9E-1152278IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
XAHFTANQAI LEAFQGKNRV HVIDFSMNQG MQWPALMQAL ALRPGGPPAF RLTGIGPPAA  60
DNSDHLQEVG WKLAQLAETI HVEFEYRGFV ANSLADLDAS MLELRPSETE AVAVNSVFEL  120
HKLLARPGAV EKVLSVVRQI RPEIVTVVEQ EANHNGPGFL DRFTESLHYY STMFDSLEGS  180
VNSQDKVMSE VYLGKQICNV VACEGVDRVE RHETLGQWRT RFGSAGFAPV HLGSNAFKQA  240
SMLLALFAGG DGYRVEENNG CLMLGWHTRP LIATSAWQLA TKTVVAH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-47227893375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016191184.10.0PREDICTED: DELLA protein GAIP-B-like
SwissprotQ5BN220.0RGA2_BRACM; DELLA protein RGA2
SwissprotQ5BN230.0RGA1_BRACM; DELLA protein RGA1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLM5XLL40.0M5XLL4_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein